$ cat recipes/lunchbox-brazilian-coconut-lime-breakfast-wrap-cup-4234.md

Lunchbox Brazilian Coconut Lime Breakfast Wrap Cup

Name: Lunchbox Brazilian Coconut Lime Breakfast Wrap Cup
Prep time: 11 min
Cook time: 37 min
Total time: 48 min
Yield: 5 servings
Ingredients: lunchbox brazilian coconut; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lunchbox Brazilian Coconut Lime Breakfast Wrap Cup is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Lunchbox Brazilian Coconut Lime Breakfast Wrap Cup

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       11 min
cook       37 min
total      48 min
servings   5
protein    44 g
pantry     86/100

categorybreakfastdietpescatarianleveleasykcal501

$ price recipe --region auto

Estimating local basket...

Ingredients

lunchbox brazilian coconut
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.