$ cat recipes/lunchbox-brazilian-sweet-potato-scramble-hash-3344.md

Lunchbox Brazilian Sweet Potato Scramble Hash

Name: Lunchbox Brazilian Sweet Potato Scramble Hash
Prep time: 25 min
Cook time: 39 min
Total time: 64 min
Yield: 5 servings
Ingredients: lunchbox brazilian sweet; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lunchbox Brazilian Sweet Potato Scramble Hash is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Lunchbox Brazilian Sweet Potato Scramble Hash

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       25 min
cook       39 min
total      64 min
servings   5
protein    40 g
pantry     95/100

categorybreakfastdietpescatarianleveleasykcal401

$ price recipe --region auto

Estimating local basket...

Ingredients

lunchbox brazilian sweet
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.