$ cat recipes/lunchbox-british-miso-scallion-scramble-cup-4334.md

Lunchbox British Miso Scallion Scramble Cup

Name: Lunchbox British Miso Scallion Scramble Cup
Prep time: 25 min
Cook time: 15 min
Total time: 40 min
Yield: 5 servings
Ingredients: lunchbox british miso; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lunchbox British Miso Scallion Scramble Cup is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Lunchbox British Miso Scallion Scramble Cup

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       25 min
cook       15 min
total      40 min
servings   5
protein    12 g
pantry     79/100

categorybreakfastdietpescatarianlevelmediumkcal281

$ price recipe --region auto

Estimating local basket...

Ingredients

lunchbox british miso
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.