$ cat recipes/lunchbox-french-coconut-lime-overnight-oat-hash-3144.md

Lunchbox French Coconut Lime Overnight Oat Hash

Name: Lunchbox French Coconut Lime Overnight Oat Hash
Prep time: 19 min
Cook time: 45 min
Total time: 64 min
Yield: 5 servings
Ingredients: lunchbox french coconut; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lunchbox French Coconut Lime Overnight Oat Hash is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Lunchbox French Coconut Lime Overnight Oat Hash

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       19 min
cook       45 min
total      64 min
servings   5
protein    28 g
pantry     68/100

categorybreakfastdietpescatarianlevelmediumkcal351

$ price recipe --region auto

Estimating local basket...

Ingredients

lunchbox french coconut
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.