$ cat recipes/lunchbox-indian-miso-scallion-breakfast-wrap-hash-3244.md

Lunchbox Indian Miso Scallion Breakfast Wrap Hash

Name: Lunchbox Indian Miso Scallion Breakfast Wrap Hash
Prep time: 11 min
Cook time: 23 min
Total time: 34 min
Yield: 5 servings
Ingredients: lunchbox indian miso; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lunchbox Indian Miso Scallion Breakfast Wrap Hash is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Lunchbox Indian Miso Scallion Breakfast Wrap Hash

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       11 min
cook       23 min
total      34 min
servings   5
protein    34 g
pantry     61/100

categorybreakfastdietpescatarianleveleasykcal621

$ price recipe --region auto

Estimating local basket...

Ingredients

lunchbox indian miso
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.