$ cat recipes/lunchbox-indian-spinach-feta-overnight-oat-cup-4134.md

Lunchbox Indian Spinach Feta Overnight Oat Cup

Name: Lunchbox Indian Spinach Feta Overnight Oat Cup
Prep time: 19 min
Cook time: 21 min
Total time: 40 min
Yield: 5 servings
Ingredients: lunchbox indian spinach; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lunchbox Indian Spinach Feta Overnight Oat Cup is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Lunchbox Indian Spinach Feta Overnight Oat Cup

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       19 min
cook       21 min
total      40 min
servings   5
protein    38 g
pantry     93/100

categorybreakfastdietpescatarianleveleasykcal231

$ price recipe --region auto

Estimating local basket...

Ingredients

lunchbox indian spinach
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.