$ cat recipes/lunchbox-mediterranean-garlic-butter-smoothie-bake-2654.md

Lunchbox Mediterranean Garlic Butter Smoothie Bake

Name: Lunchbox Mediterranean Garlic Butter Smoothie Bake
Prep time: 23 min
Cook time: 35 min
Total time: 58 min
Yield: 5 servings
Ingredients: lunchbox mediterranean garlic; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lunchbox Mediterranean Garlic Butter Smoothie Bake is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Lunchbox Mediterranean Garlic Butter Smoothie Bake

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       23 min
cook       35 min
total      58 min
servings   5
protein    10 g
pantry     90/100

categorybreakfastdietpescatarianlevelmediumkcal351

$ price recipe --region auto

Estimating local basket...

Ingredients

lunchbox mediterranean garlic
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.