$ cat recipes/lunchbox-mediterranean-pesto-kale-egg-muffin-hash-3544.md

Lunchbox Mediterranean Pesto Kale Egg Muffin Hash

Name: Lunchbox Mediterranean Pesto Kale Egg Muffin Hash
Prep time: 9 min
Cook time: 33 min
Total time: 42 min
Yield: 5 servings
Ingredients: lunchbox mediterranean pesto; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Lunchbox Mediterranean Pesto Kale Egg Muffin Hash is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Lunchbox Mediterranean Pesto Kale Egg Muffin Hash

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       9 min
cook       33 min
total      42 min
servings   5
protein    14 g
pantry     81/100

categorybreakfastdietpescatarianleveleasykcal451

$ price recipe --region auto

Estimating local basket...

Ingredients

lunchbox mediterranean pesto
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.