$ cat recipes/lunchbox-ontario-garlic-butter-breakfast-wrap-hash-3749.md

Lunchbox Ontario Garlic Butter Breakfast Wrap Hash

Name: Lunchbox Ontario Garlic Butter Breakfast Wrap Hash
Prep time: 8 min
Cook time: 24 min
Total time: 32 min
Yield: 5 servings
Ingredients: lunchbox ontario garlic; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Lunchbox Ontario Garlic Butter Breakfast Wrap Hash is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Lunchbox Ontario Garlic Butter Breakfast Wrap Hash

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       8 min
cook       24 min
total      32 min
servings   5
protein    13 g
pantry     81/100

categorybreakfastdietpescatarianleveleasykcal196

$ price recipe --region auto

Estimating local basket...

Ingredients

lunchbox ontario garlic
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.