$ cat recipes/market-day-french-miso-scallion-overnight-oat-bake-3154.md

Market-Day French Miso Scallion Overnight Oat Bake

Name: Market-Day French Miso Scallion Overnight Oat Bake
Prep time: 27 min
Cook time: 39 min
Total time: 66 min
Yield: 5 servings
Ingredients: market-day french miso; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Market-Day French Miso Scallion Overnight Oat Bake is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Market-Day French Miso Scallion Overnight Oat Bake

^_^ cozy
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       27 min
cook       39 min
total      66 min
servings   5
protein    40 g
pantry     96/100

categorybreakfastdietpescatarianleveleasykcal231

$ price recipe --region auto

Estimating local basket...

Ingredients

market-day french miso
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.