$ cat recipes/market-day-mediterranean-lemon-herb-toast-bake-3559.md

Market-Day Mediterranean Lemon Herb Toast Bake

Name: Market-Day Mediterranean Lemon Herb Toast Bake
Prep time: 10 min
Cook time: 24 min
Total time: 34 min
Yield: 5 servings
Ingredients: market-day mediterranean lemon; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Market-Day Mediterranean Lemon Herb Toast Bake is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Market-Day Mediterranean Lemon Herb Toast Bake

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       10 min
cook       24 min
total      34 min
servings   5
protein    13 g
pantry     82/100

categorybreakfastdietpescatarianleveleasykcal516

$ price recipe --region auto

Estimating local basket...

Ingredients

market-day mediterranean lemon
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.