$ cat recipes/market-day-mediterranean-tomato-basil-overnight-oat-plate-2669.md

Market-Day Mediterranean Tomato Basil Overnight Oat Plate

Name: Market-Day Mediterranean Tomato Basil Overnight Oat Plate
Prep time: 24 min
Cook time: 26 min
Total time: 50 min
Yield: 5 servings
Ingredients: market-day mediterranean tomato; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Market-Day Mediterranean Tomato Basil Overnight Oat Plate is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Market-Day Mediterranean Tomato Basil Overnight Oat Plate

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       24 min
cook       26 min
total      50 min
servings   5
protein    9 g
pantry     91/100

categorybreakfastdietpescatarianleveleasykcal416

$ price recipe --region auto

Estimating local basket...

Ingredients

market-day mediterranean tomato
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.