$ cat recipes/market-day-mexican-sesame-ginger-yogurt-cup-hash-4949.md

Market-Day Mexican Sesame Ginger Yogurt Cup Hash

Name: Market-Day Mexican Sesame Ginger Yogurt Cup Hash
Prep time: 22 min
Cook time: 26 min
Total time: 48 min
Yield: 5 servings
Ingredients: market-day mexican sesame; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Market-Day Mexican Sesame Ginger Yogurt Cup Hash is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Market-Day Mexican Sesame Ginger Yogurt Cup Hash

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       22 min
cook       26 min
total      48 min
servings   5
protein    9 g
pantry     79/100

categorybreakfastdietpescatarianleveleasykcal496

$ price recipe --region auto

Estimating local basket...

Ingredients

market-day mexican sesame
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.