$ cat recipes/market-day-ontario-lemon-herb-overnight-oat-hash-4649.md

Market-Day Ontario Lemon Herb Overnight Oat Hash

Name: Market-Day Ontario Lemon Herb Overnight Oat Hash
Prep time: 24 min
Cook time: 16 min
Total time: 40 min
Yield: 5 servings
Ingredients: market-day ontario lemon; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Market-Day Ontario Lemon Herb Overnight Oat Hash is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Market-Day Ontario Lemon Herb Overnight Oat Hash

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       24 min
cook       16 min
total      40 min
servings   5
protein    29 g
pantry     59/100

categorybreakfastdietpescatarianlevelmediumkcal666

$ price recipe --region auto

Estimating local basket...

Ingredients

market-day ontario lemon
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.