$ cat recipes/market-day-ontario-tomato-basil-breakfast-wrap-bake-3759.md

Market-Day Ontario Tomato Basil Breakfast Wrap Bake

Name: Market-Day Ontario Tomato Basil Breakfast Wrap Bake
Prep time: 16 min
Cook time: 18 min
Total time: 34 min
Yield: 5 servings
Ingredients: market-day ontario tomato; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Market-Day Ontario Tomato Basil Breakfast Wrap Bake is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

Recipe report: Market-Day Ontario Tomato Basil Breakfast Wrap Bake

-_- calm
  _______
 /______/|
| bowl  | |
| ready |/
`------'
prep       16 min
cook       18 min
total      34 min
servings   5
protein    25 g
pantry     68/100

categorybreakfastdietpescatarianleveleasykcal566

$ price recipe --region auto

Estimating local basket...

Ingredients

market-day ontario tomato
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.