$ cat recipes/northline-market-day-brazilian-lemon-herb-pancake-plate-102469.md

Northline Market-Day Brazilian Lemon Herb Pancake Plate

Name: Northline Market-Day Brazilian Lemon Herb Pancake Plate
Prep time: 26 min
Cook time: 34 min
Total time: 60 min
Yield: 5 servings
Ingredients: northline market-day brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Northline Market-Day Brazilian Lemon Herb Pancake Plate is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerweight-lossathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Northline Market-Day Brazilian Lemon Herb Pancake Plate

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       26 min
cook       34 min
total      60 min
servings   5
protein    31 g
pantry     75/100

categorybreakfastdietpescatarianleveleasykcal376

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

northline market-day brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.