$ cat recipes/northline-rainy-day-mediterranean-lemon-herb-breakfast-wrap-cup-101739.md

Northline Rainy-Day Mediterranean Lemon Herb Breakfast Wrap Cup

Name: Northline Rainy-Day Mediterranean Lemon Herb Breakfast Wrap Cup
Prep time: 14 min
Cook time: 16 min
Total time: 30 min
Yield: 5 servings
Ingredients: northline rainy-day mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Northline Rainy-Day Mediterranean Lemon Herb Breakfast Wrap Cup is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerweight-lossathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Northline Rainy-Day Mediterranean Lemon Herb Breakfast Wrap Cup

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       14 min
cook       16 min
total      30 min
servings   5
protein    29 g
pantry     81/100

categorybreakfastdietpescatarianlevelmediumkcal316

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

northline rainy-day mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.