$ cat recipes/northline-summer-mexican-garlic-butter-overnight-oat-bake-102104.md

Northline Summer Mexican Garlic Butter Overnight Oat Bake

Name: Northline Summer Mexican Garlic Butter Overnight Oat Bake
Prep time: 9 min
Cook time: 25 min
Total time: 34 min
Yield: 5 servings
Ingredients: northline summer mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Northline Summer Mexican Garlic Butter Overnight Oat Bake is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Northline Summer Mexican Garlic Butter Overnight Oat Bake

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       9 min
cook       25 min
total      34 min
servings   5
protein    30 g
pantry     78/100

categorybreakfastdietpescatarianleveleasykcal591

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

northline summer mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.