$ cat recipes/northline-winter-mexican-coconut-lime-yogurt-cup-plate-104969.md

Northline Winter Mexican Coconut Lime Yogurt Cup Plate

Name: Northline Winter Mexican Coconut Lime Yogurt Cup Plate
Prep time: 24 min
Cook time: 16 min
Total time: 40 min
Yield: 5 servings
Ingredients: northline winter mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Northline Winter Mexican Coconut Lime Yogurt Cup Plate is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerweight-lossathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Northline Winter Mexican Coconut Lime Yogurt Cup Plate

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       24 min
cook       16 min
total      40 min
servings   5
protein    29 g
pantry     64/100

categorybreakfastdietpescatarianleveleasykcal266

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

northline winter mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.