$ cat recipes/orchard-fall-brazilian-sweet-potato-egg-muffin-stack-081524.md

Orchard Fall Brazilian Sweet Potato Egg Muffin Stack No. 081524

Name: Orchard Fall Brazilian Sweet Potato Egg Muffin Stack No. 081524
Prep time: 23 min
Cook time: 23 min
Total time: 46 min
Yield: 5 servings
Ingredients: orchard fall brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Orchard Fall Brazilian Sweet Potato Egg Muffin Stack No. 081524 is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Orchard Fall Brazilian Sweet Potato Egg Muffin Stack No. 081524

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       23 min
cook       23 min
total      46 min
servings   5
protein    34 g
pantry     59/100

categorybreakfastdietpescatarianleveleasykcal591

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard fall brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.