$ cat recipes/orchard-fall-british-miso-scallion-egg-muffin-plate-087069.md

Orchard Fall British Miso Scallion Egg Muffin Plate No. 087069

Name: Orchard Fall British Miso Scallion Egg Muffin Plate No. 087069
Prep time: 26 min
Cook time: 40 min
Total time: 66 min
Yield: 5 servings
Ingredients: orchard fall british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Fall British Miso Scallion Egg Muffin Plate No. 087069 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Orchard Fall British Miso Scallion Egg Muffin Plate No. 087069

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       26 min
cook       40 min
total      66 min
servings   5
protein    19 g
pantry     87/100

categorybreakfastdietpescatarianleveleasykcal446

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard fall british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.