$ cat recipes/orchard-fall-mediterranean-coconut-lime-toast-bake-088054.md

Orchard Fall Mediterranean Coconut Lime Toast Bake No. 088054

Name: Orchard Fall Mediterranean Coconut Lime Toast Bake No. 088054
Prep time: 11 min
Cook time: 19 min
Total time: 30 min
Yield: 5 servings
Ingredients: orchard fall mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Orchard Fall Mediterranean Coconut Lime Toast Bake No. 088054 is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Orchard Fall Mediterranean Coconut Lime Toast Bake No. 088054

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       11 min
cook       19 min
total      30 min
servings   5
protein    42 g
pantry     98/100

categorybreakfastdietpescatarianlevelmediumkcal631

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard fall mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.