$ cat recipes/orchard-fall-mexican-spinach-feta-oat-stack-081229.md

Orchard Fall Mexican Spinach Feta Oat Stack No. 081229

Name: Orchard Fall Mexican Spinach Feta Oat Stack No. 081229
Prep time: 18 min
Cook time: 10 min
Total time: 28 min
Yield: 5 servings
Ingredients: orchard fall mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Fall Mexican Spinach Feta Oat Stack No. 081229 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Orchard Fall Mexican Spinach Feta Oat Stack No. 081229

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       18 min
cook       10 min
total      28 min
servings   5
protein    41 g
pantry     94/100

categorybreakfastdietpescatarianlevelmediumkcal456

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard fall mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.