$ cat recipes/orchard-holiday-french-sweet-potato-scramble-hash-081344.md

Orchard Holiday French Sweet Potato Scramble Hash No. 081344

Name: Orchard Holiday French Sweet Potato Scramble Hash No. 081344
Prep time: 11 min
Cook time: 17 min
Total time: 28 min
Yield: 5 servings
Ingredients: orchard holiday french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Orchard Holiday French Sweet Potato Scramble Hash No. 081344 is a cozy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Orchard Holiday French Sweet Potato Scramble Hash No. 081344

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       11 min
cook       17 min
total      28 min
servings   5
protein    8 g
pantry     88/100

categorybreakfastdietpescatarianleveleasykcal301

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard holiday french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.