$ cat recipes/orchard-holiday-ontario-sweet-potato-overnight-oat-plate-089164.md

Orchard Holiday Ontario Sweet Potato Overnight Oat Plate No. 089164

Name: Orchard Holiday Ontario Sweet Potato Overnight Oat Plate No. 089164
Prep time: 19 min
Cook time: 37 min
Total time: 56 min
Yield: 5 servings
Ingredients: orchard holiday ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Orchard Holiday Ontario Sweet Potato Overnight Oat Plate No. 089164 is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Orchard Holiday Ontario Sweet Potato Overnight Oat Plate No. 089164

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       19 min
cook       37 min
total      56 min
servings   5
protein    44 g
pantry     90/100

categorybreakfastdietpescatarianleveleasykcal541

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard holiday ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.