$ cat recipes/orchard-late-night-brazilian-tomato-basil-overnight-oat-plate-085114.md

Orchard Late-Night Brazilian Tomato Basil Overnight Oat Plate No. 085114

Name: Orchard Late-Night Brazilian Tomato Basil Overnight Oat Plate No. 085114
Prep time: 13 min
Cook time: 35 min
Total time: 48 min
Yield: 5 servings
Ingredients: orchard late-night brazilian; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Orchard Late-Night Brazilian Tomato Basil Overnight Oat Plate No. 085114 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

muscle-builderathleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Orchard Late-Night Brazilian Tomato Basil Overnight Oat Plate No. 085114

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       13 min
cook       35 min
total      48 min
servings   5
protein    10 g
pantry     66/100

categorybreakfastdietpescatarianlevelmediumkcal631

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard late-night brazilian
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.