$ cat recipes/orchard-late-night-british-sweet-potato-yogurt-cup-cup-088989.md

Orchard Late-Night British Sweet Potato Yogurt Cup Cup No. 088989

Name: Orchard Late-Night British Sweet Potato Yogurt Cup Cup No. 088989
Prep time: 22 min
Cook time: 28 min
Total time: 50 min
Yield: 5 servings
Ingredients: orchard late-night british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Late-Night British Sweet Potato Yogurt Cup Cup No. 088989 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Orchard Late-Night British Sweet Potato Yogurt Cup Cup No. 088989

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       22 min
cook       28 min
total      50 min
servings   5
protein    43 g
pantry     92/100

categorybreakfastdietpescatarianleveleasykcal436

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard late-night british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.