$ cat recipes/orchard-late-night-french-lemon-herb-pancake-plate-080469.md

Orchard Late-Night French Lemon Herb Pancake Plate No. 080469

Name: Orchard Late-Night French Lemon Herb Pancake Plate No. 080469
Prep time: 26 min
Cook time: 10 min
Total time: 36 min
Yield: 5 servings
Ingredients: orchard late-night french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Late-Night French Lemon Herb Pancake Plate No. 080469 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Orchard Late-Night French Lemon Herb Pancake Plate No. 080469

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       26 min
cook       10 min
total      36 min
servings   5
protein    41 g
pantry     98/100

categorybreakfastdietpescatarianleveleasykcal266

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard late-night french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.