$ cat recipes/orchard-late-night-taiwanese-sesame-ginger-scramble-bake-081859.md

Orchard Late-Night Taiwanese Sesame Ginger Scramble Bake No. 081859

Name: Orchard Late-Night Taiwanese Sesame Ginger Scramble Bake No. 081859
Prep time: 16 min
Cook time: 12 min
Total time: 28 min
Yield: 5 servings
Ingredients: orchard late-night taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Late-Night Taiwanese Sesame Ginger Scramble Bake No. 081859 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Orchard Late-Night Taiwanese Sesame Ginger Scramble Bake No. 081859

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       16 min
cook       12 min
total      28 min
servings   5
protein    37 g
pantry     95/100

categorybreakfastdietpescatarianlevelmediumkcal246

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard late-night taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.