$ cat recipes/orchard-lunchbox-british-tomato-basil-overnight-oat-plate-081669.md

Orchard Lunchbox British Tomato Basil Overnight Oat Plate No. 081669

Name: Orchard Lunchbox British Tomato Basil Overnight Oat Plate No. 081669
Prep time: 18 min
Cook time: 12 min
Total time: 30 min
Yield: 5 servings
Ingredients: orchard lunchbox british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Lunchbox British Tomato Basil Overnight Oat Plate No. 081669 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Orchard Lunchbox British Tomato Basil Overnight Oat Plate No. 081669

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       18 min
cook       12 min
total      30 min
servings   5
protein    37 g
pantry     96/100

categorybreakfastdietpescatarianleveleasykcal566

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard lunchbox british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.