$ cat recipes/orchard-lunchbox-japanese-sweet-potato-overnight-oat-plate-086619.md

Orchard Lunchbox Japanese Sweet Potato Overnight Oat Plate No. 086619

Name: Orchard Lunchbox Japanese Sweet Potato Overnight Oat Plate No. 086619
Prep time: 18 min
Cook time: 44 min
Total time: 62 min
Yield: 5 servings
Ingredients: orchard lunchbox japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Lunchbox Japanese Sweet Potato Overnight Oat Plate No. 086619 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Orchard Lunchbox Japanese Sweet Potato Overnight Oat Plate No. 086619

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       18 min
cook       44 min
total      62 min
servings   5
protein    11 g
pantry     98/100

categorybreakfastdietpescatarianlevelmediumkcal456

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard lunchbox japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.