$ cat recipes/orchard-rainy-day-mexican-coconut-lime-breakfast-wrap-cup-081234.md

Orchard Rainy-Day Mexican Coconut Lime Breakfast Wrap Cup No. 081234

Name: Orchard Rainy-Day Mexican Coconut Lime Breakfast Wrap Cup No. 081234
Prep time: 11 min
Cook time: 45 min
Total time: 56 min
Yield: 5 servings
Ingredients: orchard rainy-day mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Orchard Rainy-Day Mexican Coconut Lime Breakfast Wrap Cup No. 081234 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Orchard Rainy-Day Mexican Coconut Lime Breakfast Wrap Cup No. 081234

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       11 min
cook       45 min
total      56 min
servings   5
protein    28 g
pantry     67/100

categorybreakfastdietpescatarianleveleasykcal641

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard rainy-day mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.