$ cat recipes/orchard-rainy-day-ontario-spinach-feta-toast-hash-080044.md

Orchard Rainy-Day Ontario Spinach Feta Toast Hash

Name: Orchard Rainy-Day Ontario Spinach Feta Toast Hash
Prep time: 27 min
Cook time: 37 min
Total time: 64 min
Yield: 5 servings
Ingredients: orchard rainy-day ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Orchard Rainy-Day Ontario Spinach Feta Toast Hash is a savory, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Orchard Rainy-Day Ontario Spinach Feta Toast Hash

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       27 min
cook       37 min
total      64 min
servings   5
protein    44 g
pantry     97/100

categorybreakfastdietpescatarianleveleasykcal221

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard rainy-day ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.