$ cat recipes/orchard-rainy-day-taiwanese-sesame-ginger-yogurt-cup-hash-085494.md

Orchard Rainy-Day Taiwanese Sesame Ginger Yogurt Cup Hash No. 085494

Name: Orchard Rainy-Day Taiwanese Sesame Ginger Yogurt Cup Hash No. 085494
Prep time: 9 min
Cook time: 35 min
Total time: 44 min
Yield: 5 servings
Ingredients: orchard rainy-day taiwanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Orchard Rainy-Day Taiwanese Sesame Ginger Yogurt Cup Hash No. 085494 is a fresh, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Orchard Rainy-Day Taiwanese Sesame Ginger Yogurt Cup Hash No. 085494

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       9 min
cook       35 min
total      44 min
servings   5
protein    10 g
pantry     64/100

categorybreakfastdietpescatarianleveleasykcal481

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard rainy-day taiwanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.