$ cat recipes/orchard-spring-british-miso-scallion-overnight-oat-bake-081609.md

Orchard Spring British Miso Scallion Overnight Oat Bake No. 081609

Name: Orchard Spring British Miso Scallion Overnight Oat Bake No. 081609
Prep time: 14 min
Cook time: 10 min
Total time: 24 min
Yield: 5 servings
Ingredients: orchard spring british; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Spring British Miso Scallion Overnight Oat Bake No. 081609 is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Orchard Spring British Miso Scallion Overnight Oat Bake No. 081609

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       14 min
cook       10 min
total      24 min
servings   5
protein    41 g
pantry     92/100

categorybreakfastdietpescatarianleveleasykcal306

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard spring british
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.