$ cat recipes/orchard-spring-french-garlic-butter-oat-hash-082299.md

Orchard Spring French Garlic Butter Oat Hash No. 082299

Name: Orchard Spring French Garlic Butter Oat Hash No. 082299
Prep time: 16 min
Cook time: 14 min
Total time: 30 min
Yield: 5 servings
Ingredients: orchard spring french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Spring French Garlic Butter Oat Hash No. 082299 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Orchard Spring French Garlic Butter Oat Hash No. 082299

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       16 min
cook       14 min
total      30 min
servings   5
protein    33 g
pantry     97/100

categorybreakfastdietpescatarianleveleasykcal356

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard spring french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.