$ cat recipes/orchard-spring-ontario-coconut-lime-breakfast-wrap-cup-088234.md

Orchard Spring Ontario Coconut Lime Breakfast Wrap Cup No. 088234

Name: Orchard Spring Ontario Coconut Lime Breakfast Wrap Cup No. 088234
Prep time: 23 min
Cook time: 25 min
Total time: 48 min
Yield: 5 servings
Ingredients: orchard spring ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Orchard Spring Ontario Coconut Lime Breakfast Wrap Cup No. 088234 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerathleterunnerhousehold-of-4pescatarianhigh-proteingluten-freehalal-friendly

Recipe report: Orchard Spring Ontario Coconut Lime Breakfast Wrap Cup No. 088234

^_^ cozy
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       23 min
cook       25 min
total      48 min
servings   5
protein    30 g
pantry     69/100

categorybreakfastdietpescatarianleveleasykcal431

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard spring ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.