$ cat recipes/orchard-summer-korean-pesto-kale-pancake-bake-087459.md

Orchard Summer Korean Pesto Kale Pancake Bake No. 087459

Name: Orchard Summer Korean Pesto Kale Pancake Bake No. 087459
Prep time: 8 min
Cook time: 34 min
Total time: 42 min
Yield: 5 servings
Ingredients: orchard summer korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Summer Korean Pesto Kale Pancake Bake No. 087459 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Orchard Summer Korean Pesto Kale Pancake Bake No. 087459

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       8 min
cook       34 min
total      42 min
servings   5
protein    31 g
pantry     72/100

categorybreakfastdietpescatarianlevelmediumkcal666

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard summer korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.