$ cat recipes/orchard-summer-mexican-sesame-ginger-oat-plate-081219.md

Orchard Summer Mexican Sesame Ginger Oat Plate No. 081219

Name: Orchard Summer Mexican Sesame Ginger Oat Plate No. 081219
Prep time: 10 min
Cook time: 16 min
Total time: 26 min
Yield: 5 servings
Ingredients: orchard summer mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Summer Mexican Sesame Ginger Oat Plate No. 081219 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Orchard Summer Mexican Sesame Ginger Oat Plate No. 081219

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       10 min
cook       16 min
total      26 min
servings   5
protein    29 g
pantry     66/100

categorybreakfastdietpescatarianleveleasykcal576

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard summer mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.