$ cat recipes/orchard-summer-ontario-corn-pepper-scramble-bake-082809.md

Orchard Summer Ontario Corn Pepper Scramble Bake No. 082809

Name: Orchard Summer Ontario Corn Pepper Scramble Bake No. 082809
Prep time: 6 min
Cook time: 12 min
Total time: 18 min
Yield: 5 servings
Ingredients: orchard summer ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Summer Ontario Corn Pepper Scramble Bake No. 082809 is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Orchard Summer Ontario Corn Pepper Scramble Bake No. 082809

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       6 min
cook       12 min
total      18 min
servings   5
protein    37 g
pantry     90/100

categorybreakfastdietpescatarianleveleasykcal606

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard summer ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.