$ cat recipes/orchard-sunday-french-sesame-ginger-yogurt-cup-hash-085949.md

Orchard Sunday French Sesame Ginger Yogurt Cup Hash No. 085949

Name: Orchard Sunday French Sesame Ginger Yogurt Cup Hash No. 085949
Prep time: 10 min
Cook time: 28 min
Total time: 38 min
Yield: 5 servings
Ingredients: orchard sunday french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Sunday French Sesame Ginger Yogurt Cup Hash No. 085949 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Orchard Sunday French Sesame Ginger Yogurt Cup Hash No. 085949

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       10 min
cook       28 min
total      38 min
servings   5
protein    43 g
pantry     67/100

categorybreakfastdietpescatarianleveleasykcal656

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard sunday french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.