$ cat recipes/orchard-sunday-japanese-sweet-potato-egg-muffin-stack-082079.md

Orchard Sunday Japanese Sweet Potato Egg Muffin Stack No. 082079

Name: Orchard Sunday Japanese Sweet Potato Egg Muffin Stack No. 082079
Prep time: 16 min
Cook time: 32 min
Total time: 48 min
Yield: 5 servings
Ingredients: orchard sunday japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Sunday Japanese Sweet Potato Egg Muffin Stack No. 082079 is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Orchard Sunday Japanese Sweet Potato Egg Muffin Stack No. 082079

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       16 min
cook       32 min
total      48 min
servings   5
protein    35 g
pantry     96/100

categorybreakfastdietpescatarianleveleasykcal546

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard sunday japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.