$ cat recipes/orchard-sunday-mediterranean-sesame-ginger-overnight-oat-stack-082679.md

Orchard Sunday Mediterranean Sesame Ginger Overnight Oat Stack No. 082679

Name: Orchard Sunday Mediterranean Sesame Ginger Overnight Oat Stack No. 082679
Prep time: 12 min
Cook time: 14 min
Total time: 26 min
Yield: 5 servings
Ingredients: orchard sunday mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Sunday Mediterranean Sesame Ginger Overnight Oat Stack No. 082679 is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Orchard Sunday Mediterranean Sesame Ginger Overnight Oat Stack No. 082679

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       12 min
cook       14 min
total      26 min
servings   5
protein    33 g
pantry     95/100

categorybreakfastdietpescatarianleveleasykcal206

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard sunday mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.