$ cat recipes/orchard-sunday-mexican-corn-pepper-smoothie-stack-082179.md

Orchard Sunday Mexican Corn Pepper Smoothie Stack No. 082179

Name: Orchard Sunday Mexican Corn Pepper Smoothie Stack No. 082179
Prep time: 8 min
Cook time: 10 min
Total time: 18 min
Yield: 5 servings
Ingredients: orchard sunday mexican; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Sunday Mexican Corn Pepper Smoothie Stack No. 082179 is a bright, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderweight-lossathleterunnerhousehold-of-4pescatarianhigh-protein

Recipe report: Orchard Sunday Mexican Corn Pepper Smoothie Stack No. 082179

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       8 min
cook       10 min
total      18 min
servings   5
protein    41 g
pantry     89/100

categorybreakfastdietpescatarianleveleasykcal326

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard sunday mexican
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.