$ cat recipes/orchard-sunday-ontario-sweet-potato-yogurt-cup-cup-081989.md

Orchard Sunday Ontario Sweet Potato Yogurt Cup Cup No. 081989

Name: Orchard Sunday Ontario Sweet Potato Yogurt Cup Cup No. 081989
Prep time: 10 min
Cook time: 10 min
Total time: 20 min
Yield: 5 servings
Ingredients: orchard sunday ontario; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Sunday Ontario Sweet Potato Yogurt Cup Cup No. 081989 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Orchard Sunday Ontario Sweet Potato Yogurt Cup Cup No. 081989

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       10 min
cook       10 min
total      20 min
servings   5
protein    41 g
pantry     90/100

categorybreakfastdietpescatarianleveleasykcal646

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard sunday ontario
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.