$ cat recipes/orchard-winter-french-corn-pepper-overnight-oat-stack-088629.md

Orchard Winter French Corn Pepper Overnight Oat Stack No. 088629

Name: Orchard Winter French Corn Pepper Overnight Oat Stack No. 088629
Prep time: 20 min
Cook time: 16 min
Total time: 36 min
Yield: 5 servings
Ingredients: orchard winter french; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Winter French Corn Pepper Overnight Oat Stack No. 088629 is a warm, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainerweight-lossathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Orchard Winter French Corn Pepper Overnight Oat Stack No. 088629

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       20 min
cook       16 min
total      36 min
servings   5
protein    29 g
pantry     68/100

categorybreakfastdietpescatarianleveleasykcal346

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard winter french
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.