$ cat recipes/orchard-winter-japanese-tomato-basil-oat-bake-085754.md

Orchard Winter Japanese Tomato Basil Oat Bake No. 085754

Name: Orchard Winter Japanese Tomato Basil Oat Bake No. 085754
Prep time: 19 min
Cook time: 31 min
Total time: 50 min
Yield: 5 servings
Ingredients: orchard winter japanese; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

^_^ cozy - Orchard Winter Japanese Tomato Basil Oat Bake No. 085754 is a silky, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

weight-lossrunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Orchard Winter Japanese Tomato Basil Oat Bake No. 085754

^_^ cozy
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       19 min
cook       31 min
total      50 min
servings   5
protein    18 g
pantry     95/100

categorybreakfastdietpescatarianleveleasykcal301

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard winter japanese
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.