$ cat recipes/orchard-winter-korean-sweet-potato-pancake-cup-087439.md

Orchard Winter Korean Sweet Potato Pancake Cup No. 087439

Name: Orchard Winter Korean Sweet Potato Pancake Cup No. 087439
Prep time: 14 min
Cook time: 8 min
Total time: 22 min
Yield: 5 servings
Ingredients: orchard winter korean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Winter Korean Sweet Potato Pancake Cup No. 087439 is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

runnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Orchard Winter Korean Sweet Potato Pancake Cup No. 087439

-_- calm
  .-====-.
 /  BRK  \
|  stir   |__
 \  plate /--`
  `-..-'
prep       14 min
cook       8 min
total      22 min
servings   5
protein    7 g
pantry     98/100

categorybreakfastdietpescatarianleveleasykcal416

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard winter korean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.