$ cat recipes/orchard-winter-mediterranean-miso-scallion-breakfast-wrap-hash-081799.md

Orchard Winter Mediterranean Miso Scallion Breakfast Wrap Hash No. 081799

Name: Orchard Winter Mediterranean Miso Scallion Breakfast Wrap Hash No. 081799
Prep time: 12 min
Cook time: 10 min
Total time: 22 min
Yield: 5 servings
Ingredients: orchard winter mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Winter Mediterranean Miso Scallion Breakfast Wrap Hash No. 081799 is a zippy, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

trainermuscle-builderathleterunnerhousehold-of-4pescatarianhigh-proteingluten-free

Recipe report: Orchard Winter Mediterranean Miso Scallion Breakfast Wrap Hash No. 081799

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       12 min
cook       10 min
total      22 min
servings   5
protein    41 g
pantry     91/100

categorybreakfastdietpescatarianleveleasykcal476

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard winter mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.