$ cat recipes/orchard-winter-mediterranean-miso-scallion-oat-hash-086249.md

Orchard Winter Mediterranean Miso Scallion Oat Hash No. 086249

Name: Orchard Winter Mediterranean Miso Scallion Oat Hash No. 086249
Prep time: 8 min
Cook time: 38 min
Total time: 46 min
Yield: 5 servings
Ingredients: orchard winter mediterranean; rolled oats; parsley; cumin; olive oil; kosher salt; black pepper; garlic; lemon

-_- calm - Orchard Winter Mediterranean Miso Scallion Oat Hash No. 086249 is a crisp, low-friction breakfast recipe tuned for clear timing, common pantry support, and a straight path from prep to plate.

athleterunnerhousehold-of-4pescatariangluten-freehalal-friendly

Recipe report: Orchard Winter Mediterranean Miso Scallion Oat Hash No. 086249

-_- calm
  .---.
 / BRK \
|  egg  |
 \_ _ _/
  |___|
prep       8 min
cook       38 min
total      46 min
servings   5
protein    23 g
pantry     87/100

categorybreakfastdietpescatarianleveleasykcal486

$ price recipe --region auto

Estimating local basket from the detected market...

Ingredients

orchard winter mediterranean
rolled oats
parsley
cumin
olive oil
kosher salt
black pepper
garlic
lemon

Steps

Prep all vegetables, aromatics, and protein before heat touches the pan.
Build flavor with oil, salt, aromatics, and the main ingredient over steady heat.
Add liquid or sauce in stages, tasting once midway and once before serving.
Plate hot with herbs, acid, and a final grind of pepper.